The microtuble interaction site
This page leads you to internet information about microtubules (MTs) and factors that interact with them. It provides only a selection of the information available on the internet.
Not all links are checked! They may lead to dead sites!!! Corrections and additions are in progress.
Introduction
Structure and function of microtubules: The Cell: A Molecular ApproachImages of the microtubule cytoskeleton: The Cell: An Image Library
Key research publications
Microtubule dynamic instability: Mitchison and Kirschner, 1984Microtubule dynamics in living cells: Sammack and Borisy, 1988
High-resolution model of the microtubule: Nogales et al., 1999
Tubulin code: Janke et al., 2005; Rogowski et al., 2009
Mechanisms of microtubule interactions: Schnitzer and Block, 1997; Tirnauer et al., 2002; Janning et al., 2014; Igaev et al., 2014
MT/tubulin-binding proteins
This is a selection of factors where information about MT/tubulin-binding sequences and/or cellular function is available. Clicking on a sequence will start a search for similar sequences (using the blast search at NCBI (ExPASy interface) in the non redundant database (nr)).
tau
tau (human): mainly in neurons, promotes MT assembly, stabilizes MTs, involved in Alzheimer's and other neurological diseases, amino-terminal projection domain interacts with plasmamembrane components (Brandt R'95), Weissmann 2009- REPKKVAVVRTP binds stronger than other domains (Goode BL'97)
- VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS Tau/MAP motif, binds weakly Felgner H'97, Lee G'89
- VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ Tau/MAP motif, binds weakly Felgner H'97, Lee G'89
- VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN Tau/MAP motif, binds weakly Felgner H'97, Lee G'89
- QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK Tau/MAP motif, binds weakly Felgner H'97, Lee G'89
MAP2
- MAP2 (human): stabilizes MTs (?), makes MTs stiffer (?)
MAP1B
- MAP1B (human): MT nucleation (?), MT stabilization (?)
- KKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEKKEPKKEVKKETPPKEVKKEVKKEEKKEVKKEEKEPKKE MAP1B basic region containing the KKEE and KKEVI motifs for MT binding
Kinesin
plus-directed motor protein, many kinesin-related proteins see also the Kinesin Home PageDynein
minus-directed motor protein, may bind indirectly to the inner plasma membrane TREMBL:O13676 {DEADposting}large fragment (around 380 amino acids) needed for microtubule binding Gee M'97, Koonce MP'97
Dynamin
motor protein, vesicular traffic, endocytosis (liberation of vesicles from plasma membrane), GTPaseNTTTVSTPMPPP..PSRSGQASPSRPESPRPPFDL proline-rich domain (PRD) at the C-terminus, modestly conserved (esp. VPSRP, search PROSITE), believed to mediate interactions between dynamin and other proteins (incl. MTs, although this has not been shown in vivo) McNiven MA'98, Urrutia R'97
CBF5
(yeast): binds to centromeres and MTs (??), mitotic chromosome segregation, essential for cell growthKKDKKEKKEKKDKKEKKEKKEKKEKKRKAD 9 x 3 AA tandem repeats of K-K-[DE]
SPC98
binds to gamma-tubulin (important for MT nucleation), concentrated at the centrosome Tassin AM'98; conserved between human and yeast (esp. GWDVF, FNFLWR; search PROSITE)Gephyrin
membrane protein-cytoskeleton interactions, associated with inhibitory glycine receptor (anchors it to subsynaptic MTs?)Plectin
link between MTs and intermediate filaments (?)clip170
links endosomes to MTs Pierre P'94STOP
calmodulin-regulated, MT stabilization Guillaud L'98Ezrin-like proteins
may link MTs to the plasma membraneCaldesmon
may bind actin and MTs Gavin RH'97MAP1A
may link MTs and actin Pedrott B'94General
In general, MT-binding domains tend to be:- rich in valine (V, 6-25%), lysine (K, 11-46%), proline (P, 3-17%), and glycine (G, 0-22%)
- basic (around pI 9-11)
Misc
- ftsZ tubulin-like protein in prokaryotes; PROSITE entry
- atomic model of tubulin research news article from Berkeley Lab
- mapmodulin: binds to free MAPs tubulin-binding domain (MAP2, MAP4, tau), regulated by phosphorylation (?) Ulitzur N'97
Search
The search buttons are not yet implemented!Changelog
- September 1998 initially created by Dr. Michael Rebhan
- January 2004 links corrected by Christian Rickert (AG Brandt)
- January 2014 updated and transfered to mozilo CMS by Fred Sündermann (AG Brandt)